- Recombinant Saccharomyces cerevisiae Copper transport protein CTR2 (CTR2)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1092120
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 21,651 Da
- E Coli or Yeast
- 1-189
- Copper transport protein CTR2 (CTR2)
Sequence
MDDKKTWSTVTLRTFNQLVTSSLIGYSKKMDSMNHKMEGNAGHDHSDMHMGDGDDTCSMNMLFSWSYKNTCVVFEWWHIKTLPGLILSCLAIFGLAYLYEYLKYCVHKRQLSQRVLLPNRSLTKINQADKVSNSILYGLQVGFSFMLMLVFMTYNGWLMLAVVCGAIWGNYSWCTSYSPEIDDSSLACH